PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009101949.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 730aa    MW: 82021 Da    PI: 7.9006
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009101949.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.84.3e-28474524252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+i+l+ l+++F++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  XP_009101949.1 474 EKDITLDILRQHFAGSLKDAAKNIGVCPTTLKRICRQHGISRWPSRKIKKV 524
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.041460544IPR003035RWP-RK domain
PfamPF020423.9E-25477524IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2401.2E-17640726No hitNo description
PROSITE profilePS5174521.308642729IPR000270PB1 domain
SMARTSM006662.6E-19642729IPR000270PB1 domain
CDDcd064076.63E-34643726No hitNo description
SuperFamilySSF542771.04E-17643727No hitNo description
PfamPF005649.7E-15644727IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006107Biological Processoxaloacetate metabolic process
GO:0006108Biological Processmalate metabolic process
GO:0005515Molecular Functionprotein binding
GO:0050152Molecular Functionomega-amidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MLASISSLAL TQSWLTNFIC RSLVHHILVN YLYFVCKYRG MLMQMEESNN SGVVDFPENF  60
MDQLLWEECR GEEEEVSLWS SLGLKERVTC AMGHLQEVMG GEKELLIQLW VPVERGMRRV  120
LSTEEQPYSL NLFSQSQSLA LYRDISAGYS FAAEVGSDQL VGLPGRVFLN RMPEWTPDVR  180
FFRSEEYLRI GYAHRCQVRA SLALPLFQGP SGTCMGVLEM ITTHPSLEYG SQLHTIHHAL  240
QAFDLRSSET SIVPTSLKMV PFPLPPQPHT DDDLHREVAS ILKGICISYG LPLAITWGHQ  300
QDSCLSAIVS ASYASDQNSR SFLDACSEHH LVAKEGIAGR AFATKKQYIA KDVAILSYPL  360
SHYAKMFDLH AALAIPLLTR YSRNVQFVLE FFFPRDYYCL INQRPILLAS QLSLRFQSSP  420
HLMVDDDQLK LAECMSRKGK GKDVSVSWEM REPSSFSSSS SSCLESRKRK RRDEKDITLD  480
ILRQHFAGSL KDAAKNIGVC PTTLKRICRQ HGISRWPSRK IKKVGHSLRK LQVVMDSVEG  540
VQGSHHLASF YSSFPQLQSP LQLDPTKTVA KSPPPSSSSS SGSSTCCSSE EKDKQLGGGF  600
HKPSSQVLLT LGSSLMKDEQ RPVRATSSLP PLPSARKAKD AGMKVHAMFG DSKMRMRLKH  660
HWGIADLRRE IAKGFGMDDD ALTSNFTLKY MDDDEEWVLL TCDADLEECI QIYKSSLYKE  720
TVRISVSSLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1466471RKRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009101949.10.0PREDICTED: protein NLP3 isoform X1
SwissprotQ9SVF10.0NLP3_ARATH; Protein NLP3
TrEMBLA0A078IZE00.0A0A078IZE0_BRANA; BnaA06g40940D protein
TrEMBLM4EXM40.0M4EXM4_BRARP; Uncharacterized protein
STRINGBra033561.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152871718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38340.10.0Nin-like family protein